PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g10340.1.p
Common NameBRADI_2g10340, LOC100830305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 312aa    MW: 34334.3 Da    PI: 10.7255
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g10340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding444.9e-144287147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ed +l ++v+++G+ +W++ a+ +   R++k+c++rw++ 
  Bradi2g10340.1.p 42 RGHWRPHEDAKLRELVREFGPQNWNLMAEQIE-SRSGKSCRLRWFNQ 87
                      899*****************************.***********996 PP

2Myb_DNA-binding45.51.8e-1496137346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +T+eE+++l   ++  G++ W+  ar+++ gRt++ +k++w+ 
  Bradi2g10340.1.p  96 GFTAEEEDRLMAMHRACGNR-WAYLARHFP-GRTDNAVKNHWHV 137
                       59******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.8363792IPR017930Myb domain
SuperFamilySSF466892.77E-2639135IPR009057Homeodomain-like
SMARTSM007178.1E-124190IPR001005SANT/Myb domain
PfamPF002491.4E-134287IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-234395IPR009057Homeodomain-like
CDDcd001673.65E-114586No hitNo description
SMARTSM007171.4E-1093141IPR001005SANT/Myb domain
PROSITE profilePS5129415.87194143IPR017930Myb domain
PfamPF002496.0E-1196137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1796138IPR009057Homeodomain-like
CDDcd001671.07E-897138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAAREAMNGA LPPPPAPVQE EEEQQPQQGQ GQGQGRSSGI VRGHWRPHED AKLRELVREF  60
GPQNWNLMAE QIESRSGKSC RLRWFNQLDP RIERRGFTAE EEDRLMAMHR ACGNRWAYLA  120
RHFPGRTDNA VKNHWHVLNA RRERQQSGNP VRRRRNKSSS KSSSSSSSTS SASSSARRHQ  180
PPPPPVSAAP PPLYHPHPHS FSAPLYSAHG GHPLGGAAYS SGESSSSAST CTTDFTLYGG  240
SHRKGLDVMA PPPPPQPQPL QAFKPSGRSA FVAPPPKKLL PRPRVDQEPS KQEEANKPKL  300
PFFDFLGVGD V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29401365101B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754344.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLI1HEF40.0I1HEF4_BRADI; Uncharacterized protein
STRINGBRADI2G10340.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-54myb domain protein 105